PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00566.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 324aa    MW: 35176.9 Da    PI: 8.9346
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00566.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof100.61e-3173132261
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              +e+a++cprC+s ntkfCyynny+ +qPr++CkaCrryWt GG lr++P Gg rr+n k+
  Rsa1.0_00566.1_g00012.1  73 PEAAQNCPRCNSINTKFCYYNNYNPTQPRHYCKACRRYWTDGGKLRDIPEGGRRRRNSKK 132
                              57889**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2161121IPR003851Zinc finger, Dof-type
PfamPF027011.3E-2976131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.31977131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVFSSNWSQP TNPSQLQLRE NGSLVNGHEL LSHQLPPFPS NPNIHHAAAS SVLPAMLGGY  60
MAERARQPKA PRPEAAQNCP RCNSINTKFC YYNNYNPTQP RHYCKACRRY WTDGGKLRDI  120
PEGGRRRRNS KKNKNGSSKS PSSSSILPSP TVNAPSSSSG QLGTNHQFPF LPTLQHLTQL  180
GGIGLNLAAA NGNNQAHQYG AGLMNDLGFL HVGDGRNNVA PVTGNIHDND NNNGENNLMG  240
SGGFTLFDPT SGLHAFQNEG NIRNNVSFSP TSMVDSRIYQ TGPVNMEEQP DLVSLSGPVS  300
GLTPPVNQIN QYVWKNSDFS DPSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842841e-143FJ584284.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716265.11e-165PREDICTED: dof zinc finger protein DOF1.1
SwissprotQ8L9V61e-123DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A078F0991e-165A0A078F099_BRANA; BnaA09g49290D protein
STRINGBra031588.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.33e-97Dof family protein